.
135,361 domains match your criteria
Domain Company Country Category IAB Category Rank Monthly Visits
attrailercenter.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
gentryaviation.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
zonelogistic.hu - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
inasidigua.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
broering.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
cargotek.lt - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
javetenterprise.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
a1commercialrepairs.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
goodshippingcontainers.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
temporarywarehousebuildings934017.icu - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
nordicswift.fi - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
lcxfresh.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
koraillogis.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
kostgroupe.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
excellentquality.hu - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
securitystoragetc.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
asean-jsc.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
traveldesk.mx - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
crfreightsystems.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
globalacmi.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
lixtaparking.jp - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
martincargo.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
locallegendlabs.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
savia.id - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
miltsp.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
uhlig-wehling.de - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
kienvang.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
bccarrier.ro - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
myboxtrucksolutions.com Box Truck Solutions US /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
americacartransport.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
mynewworktruck.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
eastvalleyselfstorage.net - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
mmlogik.is - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
inventorymanagement501470.icu - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
geneveshipping.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
shipfastlogistics.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
narprail.org - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
netakonteyner.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
nslogistics.pl - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
omsan.eu - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
onnway.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
openport.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
kelleyandkelleylogistics.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
asgard-kina.me - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
lider-move.ru - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
print-dienstleistung.de - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
malatyaevdenevenakliyatkygrp.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
railcarrx.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
allamericanstagelines.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
rhfocus.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
rigaprecast.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
rentcontainerstorage459691.icu - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
royaltyspeed.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
northlincsstorage.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
prevoz-nemacka.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
bondtrailerserviceus.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
bicountyautopartsny.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
regionaltruckil.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
cnlogisticsbna.net - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
whalelogistics.us - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
mjstorageflorida.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
skypoint-park.ru - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
skytrack.net - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
amcommercials.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
getlogan.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
jedrusbus.pl - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
egemertotokurtarma.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
larkinexpress.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
gdgt.pl - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
freightmasters.lt - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
shipping-container-homes-kr.store - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
thisisyourcaptainspeakingfilm.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
icuesses.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
ssscouts.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
funtourtransport.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
cmashippingevent.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
caddyshackstorage.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
ramtreyler.ru - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
otskydrone.sa - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
tli-translog.ch - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
globalexpress.md - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
tailordinsurance.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
tehmobil.ru - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
selfstoragewexford.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
safround-shipping.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
landmarktransportinc.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
creasenaleticas.cl - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
freightnorthcarriers.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
wieltrans.pl - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
blueribbonky.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
girondelogistics.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
herbertsales.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
republicaviation.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
freightsync.us - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
innoveroglobal.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
sheltonlogisticsva.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
bubbalogistics.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
macpiper.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
pslexpress.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
bigboysbodyshop.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -