.
135,377 domains match your criteria
Domain Company Country Category IAB Category Rank Monthly Visits
mabonpallets.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
danball-hompo.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
elitefleetdrivers.org - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
jandstrailerent.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
yjcfreight.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
hepamechanika.hu - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
sellyourtrucks.com.au - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
avionicsconnect.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
logistica-central.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
mmdserviss.eu - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
vbz-bremen.de - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
lifecouriers.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
dopravamnichov.sk - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
warriorsaviationservices.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
agrotex.hu - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
transportesegurolog.com.br - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
devfilo.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
domino-bus.pl - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
flywithjohnny.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
v1rotate.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
pusulakargo.com.tr - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
universodascarretinhas.com.br - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
jingloballogistics.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
buynowcars.com.ua - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
ttandtroadsideservices.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
bblogisticsgroup.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
taxfreerv.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
fretadovale.com.br - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
solutionstmd.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
connecthighways.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
designatedfaaagent.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
deltaambalaj.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
cbmpartners.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
ozcanbeynakliyat.net - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
covenantlogistics.co.za - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
aktallogistics.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
ilxlogistics.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
big12towingllc.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
pandamall.vn - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
wdelogistics.co.uk - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
isdd.io - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
bitumix.cl - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
ublpackaging.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
bcmaskinstation.dk - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
wr.group - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
flyelev8aviation.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
timret.com.pl - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
lemmecargo.com.br - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
doserlojistik.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
icsinternationalcargoservice.it - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
acrlogisticscarrier.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
ofimmsa.mx - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
newnetexpress.co.uk - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
middletontransport.com.au - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
mktrucking.com.au - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
tms-iot.be - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
paslaservices.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
topczechtransport.cz - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
agmitransport.pl - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
alfaglobaltransport.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
grumaq.cl - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
imminglogistics.nl - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
containersnorthwest.co.uk - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
conexfrete.com.br - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
poyraznakliyat.net - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
aocsa.es - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
agrievdenevenakliyatfirmalari.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
eviklogistics.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
exportdash.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
mercerdrivingjobs.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
hbe.cl - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
tricircle.co.uk - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
logisrch.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
alostool.com.sa - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
checkandship.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
technofluid.it - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
redmudancas.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
mevanakliyat.com.tr - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
facilitavt.com.br - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
akmet.net.pl - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
capitalsedanandtaxi.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
guardemaissbc.com.br - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
magnumstorage.co.uk - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
go-flyt.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
logixtic.co - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
fundacionubu.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
cdlpro.net - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
skymaxcontainers.com - - /Business & Industrial/Transportation & Logistics/Freight & Trucking Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
colivraison24h.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
dhlsupplychain.dhl.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
mep-capital.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
chungchinghiepvu.edu.vn - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
mikalogi.jp - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
cdbox.co.il - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
cognitia.ec - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
flatbrookstoragerv.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
skiagczard.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
container-ichiba.jp - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
bustec-info.de - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -
gcs-containers.com - - /Business & Industrial/Transportation & Logistics Logistics and Transportation Industry/Business and Finance/Industries/Logistics and Transportation Industry - -